Proteintech, 66705-1-Ig, LIG4 Monoclonal antibody

Size: 20ul / 150ul The LIG4 (66705-1-Ig) by Proteintech is a Monoclonal antibody targeting LIG4 in WB, IF/ICC, ELISA applications with reactivity to human samples 66705-1-Ig targets LIG4 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells, HeLa cells, HepG2 cells, Jurkat cells, Ramos cells, human testis tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Two major pathways, homologous recombination (HR) and nonhomologous end joining (NHEJ), counteract one of themost toxic lesions, the DSB. The core protein complex mediating NHEJ in mammals includes DNA ligase IV (Lig4). Lig4 belongs to an ATP-dependent DNA ligase family, and joins single-strand brdownloadeaks in a double-stranded polydeoxynucleotide in an ATP-dependent reaction. The complex Lig4-XRCC4 is responsible for the NHEJ ligation step, and XRCC4 enhances the joining activity of Lig4. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3385 Product name: Recombinant human LIG4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 606-911 aa of BC037491 Sequence: ASGKLASKHLYIGGDDEPQEKKRKAAPKMKKVIGIIEHLKAPNLTNVNKISNIFEDVEFCVMSGTDSQPKPDLENRIAEFGGYIVQNPGPDTYCVIAGSENIRVKNIILSNKHDVVKPAWLLECFKTKSFVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFIDTDLNQLKEVFSGIKNSNEQTPEEMASLIADLEYRYSWDCSPLSMFRRHTVYLDSYAVINDLSTKNEGTRLAIKALELRFHGAKVVSCLAEGVSHVIIGEDHSRVADFKAFRRTFKRKFKILKESWVTDSIDKCELQEENQYLI Predict reactive species Full Name: ligase IV, DNA, ATP-dependent Calculated Molecular Weight: 911 aa, 104 kDa Observed Molecular Weight: 100-104 kDa GenBank Accession Number: BC037491 Gene Symbol: LIG4 Gene ID (NCBI): 3981 RRID: AB_2882057 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P49917 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.