Iright
BRAND / VENDOR: Proteintech

Proteintech, 66706-1-Ig, MTAP Monoclonal antibody

CATALOG NUMBER: 66706-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MTAP (66706-1-Ig) by Proteintech is a Monoclonal antibody targeting MTAP in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 66706-1-Ig targets MTAP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, HCT 116 cells, HSC-T6 cells, Raji cells, HT-29 cells Positive IHC detected in: mouse liver tissue, human kidney tissue, rat liver tissue, mouse kidney tissue, human colon cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information MTAP is a 5-deoxy-5-methylthioadenosine (MTA) phosphorylase, converting MTA to salvageable intermediates including adenine and 5-methylthioribose-1-phosphate. MTAP is abundant in normal cells, but it is frequently found to be deleted in a variety of cancers. Its deficiency is common in cancer cell lines as well as in primary leukemia, lung cancer, melanoma, bladder cancer, gliomas and breast cancer. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17954 Product name: Recombinant human MTAP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-154 aa of BC018625 Sequence: MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS Predict reactive species Full Name: methylthioadenosine phosphorylase Calculated Molecular Weight: 283 aa, 31 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC018625 Gene Symbol: MTAP Gene ID (NCBI): 4507 RRID: AB_2882058 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q13126 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924