Iright
BRAND / VENDOR: Proteintech

Proteintech, 66722-1-Ig, Factor VIII Monoclonal antibody

CATALOG NUMBER: 66722-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Factor VIII (66722-1-Ig) by Proteintech is a Monoclonal antibody targeting Factor VIII in WB, ELISA applications with reactivity to human samples 66722-1-Ig targets Factor VIII in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma tissue, human blood tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information F8, also named as FVIII, AHF, and F8C, belongs to the multicopper oxidase family. F8, along with calcium and phospholipid, acts as a cofactor for factor IXa when it converts factor X to the activated form, factor Xa. FVIII is translated into a single-chain polypeptide (SCh) with the A1-A2-B-A3-C1-C2 domain, which can undergo glycosylation, sulfonation, and variable cleavage. The FVIII molecule is a heterodimer composed of a heavy chain (HCh, A1-A2-B domain, 90-210 kDa) and a light chain (LCh, A3-C1-C2 domain, 70-80 kDa)(PMID: 28109042; 18650448; 29292164). This antibody can recognize the light chain. Specification Tested Reactivity: human Cited Reactivity: pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag15772 Product name: Recombinant human F8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2144-2351 aa of BC022513 Sequence: VFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY Predict reactive species Full Name: coagulation factor VIII, procoagulant component Calculated Molecular Weight: 2351 aa, 267 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC022513 Gene Symbol: F8 Gene ID (NCBI): 2157 RRID: AB_2882073 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P00451 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924