Proteintech, 66723-1-Ig, HSPH1 Monoclonal antibody

Size: 20ul / 150ul The HSPH1 (66723-1-Ig) by Proteintech is a Monoclonal antibody targeting HSPH1 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse samples 66723-1-Ig targets HSPH1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, MCF-7 cells, Jurkat cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information HSP105, also known as HSP110 or HSPH1, belongs to the heat shock protein (HSP) family. Human HSP105 is a high-molecular-weight chaperone protein expressed at constitutively low levels as a cytoplasmic α-isoform and as an inducible nuclear β-isoform on exposure to various forms of stress. HSP105 is constitutively overexpressed in several solid tumors, including melanoma, breast, thyroid, and gastroenteric cancers, and exerts antiapoptotic functions. Recently HSP105 has been identified as a novel candidate biomarker of lymphoma aggressiveness. Western blot analysis using this antibody detected the phosphorylated protein around 110 kDa in various lysates. Specification Tested Reactivity: Human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27521 Product name: Recombinant human HSPH1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 508-858 aa of BC037553 Sequence: MSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADKANEKKVDQPPEAKKPKIKVVNVELPIEANLVWQLGKDLLNMYIETEGKMIMQDKLEKERNDAKNAVEEYVYEFRDKLCGPYEKFICEQDHQNFLRLLTETEDWLYEEGEDQAKQAYVDKLEELMKIGTPVKVRFQEAEERPKMFEELGQRLQHYAKIAADFRNKDEKYNHIDESEMKKVEKSVNEVMEWMNNVMNAQAKKSLDQDPVVRAQEIKTKIKELNNTCEPVVTQPKPKIESPKLERTPNGPNIDKKEEDLEDKNNFGAEPPHQNGECYPNEKNSVNMDLD Predict reactive species Full Name: heat shock 105kDa/110kDa protein 1 Calculated Molecular Weight: 858 aa, 97 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC037553 Gene Symbol: HSPH1 Gene ID (NCBI): 10808 RRID: AB_2882074 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q92598 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.