Iright
BRAND / VENDOR: Proteintech

Proteintech, 66736-1-Ig, EPHA2 Monoclonal antibody

CATALOG NUMBER: 66736-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The EPHA2 (66736-1-Ig) by Proteintech is a Monoclonal antibody targeting EPHA2 in WB, IF/ICC, ELISA applications with reactivity to human samples 66736-1-Ig targets EPHA2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HEK-293 cells, BxPC-3 cells, MCF-7 cells, HepG2 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information EPHA2 (Ephrin type-A receptor 2) belongs to the receptor tyrosine kinase (RTK) family, with 16 known receptors and 9 known membrane-bound ligands in all species. Based on the extracellular domain sequence homology, structure, and binding affinity, Eph receptors and their ephrin ligands can be divided into A and B subtypes (PMID: 33962882). EPHA2 contains a conserved N-terminal ligand-bound extracellular domain, a transmembrane domain, and a conserved tyrosine kinase domain (PMID: 8070404). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag22566 Product name: Recombinant human EPHA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 271-535 aa of BC037166 Sequence: DACQACSPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDIVYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSGLVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSNSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNL Predict reactive species Full Name: EPH receptor A2 Calculated Molecular Weight: 976 aa, 108 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC037166 Gene Symbol: EPHA2 Gene ID (NCBI): 1969 RRID: AB_2882086 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P29317 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924