Proteintech, 66742-1-Ig, SRF Monoclonal antibody

Size: 20ul / 150ul The SRF (66742-1-Ig) by Proteintech is a Monoclonal antibody targeting SRF in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 66742-1-Ig targets SRF in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, LNCaP cells, MCF-7 cells, RAW 264.7 cells, HEK-293 cells, HepG2 cells, Jurkat cells, SK-BR-3 cells, IMR-32 cells, HSC-T6 cells, NIH/3T3 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Serum response factor (SRF) is a transcription factor that binds the serum response element (SRE), a sequence that mediates the transient response of many cellular genes to growth stimulation. SRF is required for cardiac differentiation and maturation due to the role in cardiac cell growth and muscle gene regulation. The full-length SRF protein is 67 kDa and molecular weight of cleaved fragment is 50 kDa and 20 kDa (PMID: 21769134). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10386 Product name: Recombinant human SRF protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-348 aa of BC048211 Sequence: MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREAAAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATGFEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPITNYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPG Predict reactive species Full Name: serum response factor (c-fos serum response element-binding transcription factor) Calculated Molecular Weight: 508 aa, 52 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC048211 Gene Symbol: SRF Gene ID (NCBI): 6722 RRID: AB_2882090 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P11831 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.