Proteintech, 66750-1-Ig, TSH Beta Monoclonal antibody

Size: 20ul / 150ul The TSH Beta (66750-1-Ig) by Proteintech is a Monoclonal antibody targeting TSH Beta in IHC, IF-P, ELISA applications with reactivity to Human samples 66750-1-Ig targets TSH Beta in IHC, IF-P, ELISA applications and shows reactivity with Human samples. Tested Applications Positive IHC detected in: human pituitary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human pituitary tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:3000-1:12000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27153 Product name: Recombinant human TSHB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 65-138 aa of BC069298 Sequence: YALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV Predict reactive species Full Name: thyroid stimulating hormone, beta Calculated Molecular Weight: 138 aa, 16 kDa GenBank Accession Number: BC069298 Gene Symbol: TSH beta Gene ID (NCBI): 7252 RRID: AB_2882097 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P01222 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.