Iright
BRAND / VENDOR: Proteintech

Proteintech, 66761-1-Ig, Collagen Type I Monoclonal antibody

CATALOG NUMBER: 66761-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Collagen Type I (66761-1-Ig) by Proteintech is a Monoclonal antibody targeting Collagen Type I in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 66761-1-Ig targets Collagen Type I in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: rat skin tissue, pig skin tissue, mouse tail tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Type I collagen, the major structural component of connective tissues such as skin, tendon and bone, is the most abundant and widely expressed collagen in humans (PMID: 7620364; 8645190; 9016532). Type I collagen is a heterotrimer comprising one alpha 2(I) and two alpha 1(I) chains which are encoded by the unlinked loci COL1A2 and COL1A1 respectively. Type I collagen has a molecular mass of about 250-300 kDa, while the alpha 2(I) chain has a molecular weight of about 100-140 kDa. Mutations in COL1A2 gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. When MMPs degrade type I collagen, the major degradation products are the typical ¾ and ¼ collagen fragments with molecular weights of ~ 50-70 kDa, and ~ 25 (PMID: 8910479). Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, rabbit, bovine Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6281 Product name: Recombinant human COL1A2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1017-1366 aa of BC054498 Sequence: RGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK Predict reactive species Full Name: collagen, type I, alpha 2 Calculated Molecular Weight: 1366 aa, 130 kDa Observed Molecular Weight: 140 kDa, 70-80 kDa GenBank Accession Number: BC054498 Gene Symbol: COL1A2 Gene ID (NCBI): 1278 RRID: AB_2882107 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P08123 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924