Proteintech, 66771-1-Ig, SLC25A1 Monoclonal antibody

Size: 20ul / 150ul The SLC25A1 (66771-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC25A1 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 66771-1-Ig targets SLC25A1 in WB, IP, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, NK-92 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information SLC25A1, also known as CIC or CTP, is a mitochondrial citrate transporter that exports citrate from the mitochondria to the cytosol. SLC25A1 is highly expressed in several tumor types. Recently it has been identified as a novel transcriptional target of mutant p53 and a negative tumor prognostic marker. In addition, defects in SLC25A1 has been found as a cause of combined D-2- and L-2-hydroxyglutaric aciduria. This antibody specifically recognized the endogenous SLC25A1; no protein was detected in cells from subjects containing two alleles with truncating mutations with this antibody. (24681808, 23561848) Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: mouse Host / Isotype: Mouse / IgG3 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7520 Product name: Recombinant human SLC25A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-311 aa of BC004980 Sequence: MPAPRAPRALAAAAPASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLLNKVWKTD Predict reactive species Full Name: solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1 Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC004980 Gene Symbol: SLC25A1 Gene ID (NCBI): 6576 RRID: AB_2882117 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P53007 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.