Product Description
Size: 20ul / 150ul
The KCNQ2 (66774-1-Ig) by Proteintech is a Monoclonal antibody targeting KCNQ2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples
66774-1-Ig targets KCNQ2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
Tested Applications
Positive WB detected in: pig brain tissue, rat brain tissue, mouse brain tissue
Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: U2OS cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunohistochemistry (IHC): IHC : 1:300-1:1200
Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600
Specification
Tested Reactivity: human, mouse, rat, pig
Cited Reactivity: mouse, rat
Host / Isotype: Mouse / IgG1
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag25781 Product name: Recombinant human KCNQ2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC000699 Sequence: MVQKSRNGGVYPGPSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSILSKPRAGGAGAGKPPKRNAFYRKLQNFL Predict reactive species
Full Name: potassium voltage-gated channel, KQT-like subfamily, member 2
Calculated Molecular Weight: 96 kDa
Observed Molecular Weight: 90 kDa
GenBank Accession Number: BC000699
Gene Symbol: KCNQ2
Gene ID (NCBI): 3785
RRID: AB_2882120
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein G purification
UNIPROT ID: O43526
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924