Proteintech, 66778-1-Ig, Glycophorin A/CD235a Monoclonal antibody

Size: 20ul / 150ul The Glycophorin A/CD235a (66778-1-Ig) by Proteintech is a Monoclonal antibody targeting Glycophorin A/CD235a in WB, IHC, IF-P, ELISA applications with reactivity to human samples 66778-1-Ig targets Glycophorin A/CD235a in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human blood tissue Positive IHC detected in: human placenta tissue, human stomach cancer tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:6000 Immunohistochemistry (IHC): IHC : 1:10000-1:40000 Immunofluorescence (IF)-P: IF-P : 1:400-1:1600 Background Information Glycophorin A (GYPA) is the major transmembrane sialoglycoprotein in erythrocytes. It is a dimeric type I transmembrane protein carrying 15 closely clustered O-linked tetrasaccharides capped with sialic acid/N-acetylneuraminic acid (Neu5Ac). This 36 kDa protein represents the major sialoglycoprotein of the red blood cell membrane displaying about one million copies per cell. (PMID: 9490702) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8635 Product name: Recombinant human GYPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-150 aa of BC005319 Sequence: EVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ Predict reactive species Full Name: glycophorin A (MNS blood group) Calculated Molecular Weight: 150 aa, 16 kDa Observed Molecular Weight: 36-38 kDa GenBank Accession Number: BC005319 Gene Symbol: Glycophorin A Gene ID (NCBI): 2993 RRID: AB_2882124 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P02724 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.