Proteintech, 66779-1-Ig, CD16 Monoclonal antibody

Size: 20ul / 150ul The CD16 (66779-1-Ig) by Proteintech is a Monoclonal antibody targeting CD16 in IHC, IF-P, ELISA applications with reactivity to human samples 66779-1-Ig targets CD16 in IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human liver tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:2500-1:10000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information CD16 is a 50-70-kDa low affinity Fc receptor found on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. CD16 mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis. CD16 has been identified as Fc receptors FcγRIIIa (CD16a) and FcγRIIIb (CD16b), encoded by two nearly identical genes, FCGR3A and the FCGR3B. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9787 Product name: Recombinant human CD16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-254 aa of BC017865 Sequence: FLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKDPQDK Predict reactive species Full Name: Fc fragment of IgG, low affinity IIIa, receptor (CD16a) Calculated Molecular Weight: 254 aa, 29 kDa GenBank Accession Number: BC017865 Gene Symbol: CD16a Gene ID (NCBI): 2214 ENSEMBL Gene ID: ENSG00000203747 RRID: AB_2918477 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P08637 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.