Iright
BRAND / VENDOR: Proteintech

Proteintech, 66784-1-Ig, CD52 Monoclonal antibody

CATALOG NUMBER: 66784-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CD52 (66784-1-Ig) by Proteintech is a Monoclonal antibody targeting CD52 in WB, ELISA applications with reactivity to human samples 66784-1-Ig targets CD52 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human spleen tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17788 Product name: Recombinant human CD52 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-61 aa of BC000644 Sequence: QTGLSGQNDTSQTSSPSASSSMSGGIFLFFVANAIIHLFCFS Predict reactive species Full Name: CD52 molecule Calculated Molecular Weight: 6 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC000644 Gene Symbol: CD52 Gene ID (NCBI): 1043 RRID: AB_2882129 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P31358 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924