Proteintech, 66791-1-Ig, CDR2L Monoclonal antibody

Size: 20ul / 150ul The CDR2L (66791-1-Ig) by Proteintech is a Monoclonal antibody targeting CDR2L in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples 66791-1-Ig targets CDR2L in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: U-251 cells, HEK-293 cells, K-562 cells, human brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: human cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Cerebellar degeneration-related protein 2-like(CDR2L), also named as HUMPPA or Paraneoplastic 62 kDa antigen, is a 465 amino acid protein, which belongs to the CDR2 family. CDR2L contains three potential coiled-coil regions. The functions of protein is so far not known. CDR2L is expressed in the brain and localizes in the cytoplasm. Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6139 Product name: Recombinant human CDR2L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 110-459 aa of BC047534 Sequence: TETIERLQAQVEELQAQVEQLRGLEQLRVLREKRERRRTIHTFPCLKELCTSPRCKDAFRLHSSSLELGPRPLEQENERLQTLVGALRSQVSQERQRKERAEREYTAVLQEYSELERQLCEMEACRLRVQELEAELLELQQMKQAKTYLLGPDDHLAEALLAPLTQAPEADDPQPGRGDDLGAQDGVSSPAASPGHVVRKSCSDTALNAIVAKDPASRHAGNLTLHANSVRKRGMSILREVDEQYHALLEKYEELLSKCRQHGAGVRHAGVQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPEYKALFKEIFSRIQKTKADINATKVKTHSSK Predict reactive species Full Name: cerebellar degeneration-related protein 2-like Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC047534 Gene Symbol: CDR2L Gene ID (NCBI): 30850 RRID: AB_2882135 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q86X02 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.