Proteintech, 66801-1-Ig, CCR6 Monoclonal antibody

Size: 20ul / 150ul The CCR6 (66801-1-Ig) by Proteintech is a Monoclonal antibody targeting CCR6 in IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples 66801-1-Ig targets CCR6 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Positive IF/ICC detected in: Jurkat cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information CCR6, also known as CD196, is a C-C chemokine receptor that belongs to family A of G protein-coupled receptor superfamily. It is expressed in most B cells, memory T cells, and some subsets of dendritic cells (PMID: 17057190). CCR6 is a receptor for the C-C type chemokine CCL20 (PMID: 9169459). The ligand-receptor pair CCL20-CCR6 is responsible for the chemoattraction of immature dendritic cells, effector/memory T-cells, and B-cells and plays a role in skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and rheumatoid arthritis (PMID: 12948524). CCR6 polymorphism has been associated with rheumatoid arthritis susceptibility and CCR6 is involved in IL-17-driven autoimmunity in human diseases (PMID: 20453841). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24195 Product name: Recombinant human CCR6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-47 aa of BC037960 Sequence: MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRL Predict reactive species Full Name: chemokine (C-C motif) receptor 6 Calculated Molecular Weight: 42 kDa GenBank Accession Number: BC037960 Gene Symbol: CCR6 Gene ID (NCBI): 1235 RRID: AB_2882144 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P51684 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.