Proteintech, 66812-1-Ig, Cystatin B Monoclonal antibody

Size: 20ul / 150ul The Cystatin B (66812-1-Ig) by Proteintech is a Monoclonal antibody targeting Cystatin B in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 66812-1-Ig targets Cystatin B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-937 cells, human saliva tissue, THP-1 cells Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Cystatin B (CSTB), a member of the cystatin superfamily protein, is a stefin that functions as an intracellular thiol protease inhibitor and has been thought to play a role in protecting against the proteases leaking from lysosomes. CSTB plays various functions in a variety of diseases, including epithelial ovarian cancer, colon cancer, and myoclonus epilepsy. Evidence indicates that mutations in CSTB are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1). One type of mutation responsible for EPM1 is the expansion in the promoter region of this gene of a CCCCGCCCCGCG repeat from 2-3 copies to 30-78 copies. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21291 Product name: Recombinant human CSTB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-98 aa of BC003370 Sequence: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF Predict reactive species Full Name: cystatin B (stefin B) Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 11-14 kDa GenBank Accession Number: BC003370 Gene Symbol: Cystatin B Gene ID (NCBI): 1476 RRID: AB_2882155 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P04080 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.