Proteintech, 66813-1-Ig, DIO2 Monoclonal antibody

Size: 20ul / 150ul The DIO2 (66813-1-Ig) by Proteintech is a Monoclonal antibody targeting DIO2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 66813-1-Ig targets DIO2 in WB, IHC, RIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: T-47D cells, LNCaP cells, MCF-7 cells Positive IHC detected in: human thyroid cancer tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Type II iodothyronine deiodinase(DIO2), belongs to the iodothyronine deiodinase family, with two isoform of 30 and 34 kDa. DIO2 can activates thyroid hormone by converting the prohormone thyroxine (T4) by outer ring deiodination (ORD) to bioactive 3,3',5-triiodothyronine (T3). DIO2 is thought to be responsible for the 'local' production of T3, and thus important in influencing thyroid hormone action in these tissues. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24057 Product name: Recombinant human DIO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 171-273 aa of BC074882 Sequence: AIPGDSSLSFEVKKHQNQEDRCAAAQQLLERFSLPPQCRVVADRMDNNANIAYGVAFERVCIVQRQKIAYLGGKGPFSYNLQEVRHWLEKNFSKRUKKTRLAG Predict reactive species Full Name: deiodinase, iodothyronine, type II Calculated Molecular Weight: 273 aa, 31 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC074882 Gene Symbol: DIO2 Gene ID (NCBI): 1734 RRID: AB_2882156 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q92813 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.