Proteintech, 66817-1-Ig, B7‑H4 Monoclonal antibody

Size: 20ul / 150ul The B7‑H4 (66817-1-Ig) by Proteintech is a Monoclonal antibody targeting B7‑H4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 66817-1-Ig targets B7‑H4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SKOV-3 cells, T-47D cells, HeLa cells, A549 cells Positive IHC detected in: rat kidney tissue, human cervical cancer tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information B7‑H4 also named VTCN1, B7X, or B7S1 is a 282 amino acid protein, which contains 2 immunoglobulin-like domains and belongs to the immunoglobulin superfamily. B7‑H4 negatively regulates T-cell mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. B7‑H4 is a single-pass type I membrane protein, which is over-expressed in breast, ovarian, endometrial, renal cell and non-small-cell lung cancers. The predicted molecular weight of B7‑H4 is 31 kDa. The glycosylated B7‑H4 is 50 to 80 kDa, and the non-glycosylated form is 28 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27751 Product name: Recombinant human VTCN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-187 aa of BC065717 Sequence: MFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK Predict reactive species Full Name: V-set domain containing T cell activation inhibitor 1 Calculated Molecular Weight: 282 aa, 31 kDa Observed Molecular Weight: 31-35 kDa GenBank Accession Number: BC065717 Gene Symbol: B7-H4 Gene ID (NCBI): 79679 RRID: AB_2882160 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q7Z7D3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.