Proteintech, 66818-1-Ig, ESRRB Monoclonal antibody

Size: 20ul / 150ul The ESRRB (66818-1-Ig) by Proteintech is a Monoclonal antibody targeting ESRRB in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 66818-1-Ig targets ESRRB in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, NCCIT cells, JAR cells, A549 cells, Caco-2 cells, LNCaP cells, HT-29 cells, Rat brain tissue, Mouse brain tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Caco-2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Estrogen related receptor beta (ESRRB), a NR3 Steroid Receptor, has been shown to affect early placental development. Also it can act as a repressor of transcriptional activity mediated by the glucocorticoid receptor (GR). It binds as a monomer to the extended half-site TNAAGTGCA and as a homodimer to the estrogen response element (ERE), palindromic thyroid hormone response element (TRE(pal)), and SF-1 response element, but not to the glucocorticoid response element (GRE). Estrogen related receptor beta mutations lead to abnormal development of the chorion and defective diploid trophoblast proliferation, and are lethal during midgestation. Expression has been documented in mice in the extra embryonic ectoderm that gives rise to the chorion. ESTs have been isolated from normal human eye, lung, and testis libraries. The ligand for the receptor is PPARgamma coactivator 1 (PGC-1) beta. ESRRB exists various isoforms and molecular weight of each isoform is 48 kDa,55 kDa and 56 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18626 Product name: Recombinant human ESRRB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-91 aa of BC131517 Sequence: MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDSAIKC Predict reactive species Full Name: estrogen-related receptor beta Calculated Molecular Weight: 508 aa, 56 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC131517 Gene Symbol: ESRRB Gene ID (NCBI): 2103 RRID: AB_2882161 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O95718 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.