Proteintech, 66819-1-Ig, HLA-F Monoclonal antibody

Size: 20ul / 150ul The HLA-F (66819-1-Ig) by Proteintech is a Monoclonal antibody targeting HLA-F in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 66819-1-Ig targets HLA-F in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, NCCIT cells, Raji cells, human peripheral blood leukocytes Positive IP detected in: Raji cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Raji cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:8000-1:32000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I and class II. This class I molecules are membrane glycoproteins composed of a heavy (alpha) chain which is encoded by a HLA class I gene, and β2-microglobulin light (beta) chain. The most extensively characterized members of the HLA class I gene family are the genes encoding the major transplantation antigenes, HLA-A, B and C. HLA-F is a non-classical MHC class I molecule. (PMID: 667938; 3375250; 2249951) Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6475 Product name: Recombinant human HLA-F protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 21-298 aa of BC062991 Sequence: AGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPQPLILRWEQS Predict reactive species Full Name: major histocompatibility complex, class I, F Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC062991 Gene Symbol: HLA-F Gene ID (NCBI): 3134 RRID: AB_2882162 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P30511 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.