Proteintech, 66820-1-Ig, PRDX1 Monoclonal antibody

Size: 20ul / 150ul The PRDX1 (66820-1-Ig) by Proteintech is a Monoclonal antibody targeting PRDX1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 66820-1-Ig targets PRDX1 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, U2OS cells, HEK-293 cells, Caco-2 cells, MCF-7 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells, LNCaP cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver cancer tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information PRDX1(Peroxiredoxin-1), also named as PAGA, PAGB, TDPX2, PAG or NKEF-A, belongs to the ahpC/TSA family. PRDX1 is a thiol reductase that plays critical roles in oxidative and thermal stress defense mechanisms through its abilities to metabolize H2O2 and act as a molecular chaperone, respectively. PRDX1 might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2 ((PMID: 9497357)). It reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation. PRDX1 can form a dimer, and also can be phosphorylated on Thr-90 during the M-phase, which leads to a more than 80% decrease in enzymatic activity (PMID: 22583657, 11986303). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8821 Product name: Recombinant human PRDX1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-199 aa of BC007063 Sequence: MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK Predict reactive species Full Name: peroxiredoxin 1 Calculated Molecular Weight: 199 aa, 22 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC007063 Gene Symbol: PRDX1 Gene ID (NCBI): 5052 RRID: AB_2882163 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q06830 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.