Proteintech, 66827-1-Ig, human IBA1 Monoclonal antibody

Size: 20ul / 150ul The human IBA1 (66827-1-Ig) by Proteintech is a Monoclonal antibody targeting human IBA1 in IHC, ELISA applications with reactivity to human samples 66827-1-Ig targets human IBA1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human brain tissue, human gliomas tissue, human liver cancer tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information IBA1 is a 143 amino acid cytoplasmic, inflammation response scaffold protein. It is constitutively expressed in monocytes and macrophages and is known to be involved in macrophage activation. It is a marker of activated macrophage. Expression of IBA1 is up-regulated in activated microglia following facial nerve axotomy, ischemia, and several brain diseases, thereby implicating it in the activated phenotypes of microglia. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28236 Product name: Recombinant human IBA1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-147 aa of BC009474 Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP Predict reactive species Full Name: allograft inflammatory factor 1 Calculated Molecular Weight: 17 kDa GenBank Accession Number: BC009474 Gene Symbol: IBA1 Gene ID (NCBI): 199 ENSEMBL Gene ID: ENSG00000204472 RRID: AB_2882170 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P55008 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.