Proteintech, 66836-1-Ig, NeuN Monoclonal antibody

Size: 20ul / 150ul The NeuN (66836-1-Ig) by Proteintech is a Monoclonal antibody targeting NeuN in IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 66836-1-Ig targets NeuN in IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: rat cerebellum tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat cerebellum tissue, mouse cerebellum tissue, rat brain tissue Positive FC (Intra) detected in: SH-SY5Y cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:2500-1:10000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information NeuN, encoded by FOX3, is a neuron-specific nuclear protein. Anti-NeuN stains exclusively neuronal cells in the central and peripheral nervous systems, especially postmitotic and differentiating neurons, as well as terminally differentiated neurons. Anti-NeuN has been used widely as a reliable tool to detect most postmitotic neuronal cell types. The immunohistochemical staining is primarily localized in the nucleus of the neurons with lighter staining in the cytoplasm. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, goat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28016 Product name: Recombinant human NeuN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-100 aa of NM_001082575 Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR Predict reactive species Full Name: hexaribonucleotide binding protein 3 GenBank Accession Number: NM_001082575 Gene Symbol: NeuN Gene ID (NCBI): 146713 RRID: AB_2882179 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: A6NFN3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.