Proteintech, 66842-1-Ig, TFPI Monoclonal antibody

Size: 20ul / 150ul The TFPI (66842-1-Ig) by Proteintech is a Monoclonal antibody targeting TFPI in WB, IF/ICC, ELISA applications with reactivity to human samples 66842-1-Ig targets TFPI in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue, HepG2 cells Positive IF/ICC detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Tissue factor pathway inhibitor (TFPI) is a critical anticoagulant protein present in endothelium and platelets. TFPI is produced as two major isoforms in humans, TFPIa and TFPIb that result from alternative splicing. The TFPIb isoform localizes to the endothelium surface where it is a potent inhibitor of tissue factor-factor VIIa complexes that initiate blood coagulation. The TFPIa isoform is present in platelets. TFPI is a Kunitz-type serine protease inhibitor that exerts anticoagulant activity by blocking early procoagulant stimulia. TFPI can enhance anti-thrombotic treatment in sepsis, inflammatory diseases, and cardiovascular diseases. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14980 Product name: Recombinant human TFPI protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 29-208 aa of BC015514 Sequence: DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSL Predict reactive species Full Name: tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) Calculated Molecular Weight: 251aa,29 kDa; 304aa,35 kDa Observed Molecular Weight: 35-38 kDa GenBank Accession Number: BC015514 Gene Symbol: TFPI Gene ID (NCBI): 7035 RRID: AB_2882183 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P10646 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.