Product Description
Size: 20ul / 150ul
The GLUT4 (66846-1-Ig) by Proteintech is a Monoclonal antibody targeting GLUT4 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig samples
66846-1-Ig targets GLUT4 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.
Tested Applications
Positive WB detected in: rat heart tissue, human heart tissue, C2C12 cells, human skeletal muscle tissue, rat skeletal muscle tissue, mouse heart tissue, mouse skeletal muscle tissue, mouse adipose tissue, pig heart tissue
Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: mouse skeletal muscle tissue
Positive IF/ICC detected in: HeLa cells
Positive FC (Intra) detected in: HEK-293 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:3000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)-P: IF-P : 1:200-1:800
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Background Information
Glucose transporter 4 (GLUT4), also known as solute carrier family 2, facilitated glucose transporter member 4 (SLC2A4), is a transporter protein regulating glucose transport across cell membranes in an INS-dependent manner.What is the molecular weight of GLUT4? Is GLUT4 post-translationally modified?The molecular weight of GLUT4 transporter is 55 kDa. GLUT4 can be N-glycosylated, which is important for its stability and trafficking between the recycling compartment and plasma membrane (PMID: 21757715 and 22545627), and it can also beubiquitinatedand phosphorylated (PMID: 23665900).What is the subcellular localization of GLUT4?Glucose transporters, including GLUT4, are multiple-pass integral membrane proteins. GLUT4 is present at the plasma membrane but is also a subject of recycling between plasma membrane and endosomes. The localization of GLUT4 depends on stimulation withINS- in basal conditions GLUT4 is retained intracellularly, while uponINSstimulation it is translocated to the plasma membrane (PMID: 18570632).What molecules can be transported by GLUT4?Although the main substrate of GLUT4 transport is glucose, it can also transport glucosamine.What is the tissue expression pattern of GLUT4?GLUT4 is expressed in white and brown adipose tissue and in muscle and heart cells, where it is the main glucose transporter responsible for peripheral glucose uptake in response toINS.Which cell lines can be used to study insulin-dependent GLUT4 protein translocation in glucose uptake assays?Fat and muscle cells are primarily used in glucose uptake assays because they physiologically respond toINS(PMID: 26646194). The most commonly used cell lines are 3T3-L1 cells (murine pre-adipose fibroblasts), L6 cells (rat myoblasts), and C2C12 cells (murine myoblasts).
Specification
Tested Reactivity: human, mouse, rat, pig
Cited Reactivity: human, mouse, rat, pig, zebrafish, hamster
Host / Isotype: Mouse / IgG2b
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag15390 Product name: Recombinant human GLUT4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 228-292 aa of BC069615 Sequence: RYLYIIQNLEGPARKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAV Predict reactive species
Full Name: solute carrier family 2 (facilitated glucose transporter), member 4
Calculated Molecular Weight: 509 aa, 55 kDa
Observed Molecular Weight: 48-50 kDa
GenBank Accession Number: BC069615
Gene Symbol: GLUT4
Gene ID (NCBI): 6517
RRID: AB_2882186
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P14672
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924