Proteintech, 66853-1-Ig, S100A8 Monoclonal antibody

Size: 20ul / 150ul The S100A8 (66853-1-Ig) by Proteintech is a Monoclonal antibody targeting S100A8 in IHC, IF-P, ELISA applications with reactivity to human samples 66853-1-Ig targets S100A8 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissue, human breast cancer tissue, human cervical cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8517 Product name: Recombinant human S100A8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-93 aa of BC005928 Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE Predict reactive species Full Name: S100 calcium binding protein A8 Calculated Molecular Weight: 93 aa, 11 kDa GenBank Accession Number: BC005928 Gene Symbol: S100A8 Gene ID (NCBI): 6279 RRID: AB_2882193 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P05109 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.