Proteintech, 66866-1-Ig, CD81 Monoclonal antibody

Size: 20ul / 150ul The CD81 (66866-1-Ig) by Proteintech is a Monoclonal antibody targeting CD81 in WB, IHC, IF-P, ELISA applications with reactivity to human samples 66866-1-Ig targets CD81 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, HCT 116 cells, HEK-293 cells, Jurkat cells, LPS treated THP-1 cells, Ramos cells, Daudi cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:600-1:2400 Background Information CD81 (also known as TAPA1 or TSPAN28) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD81 is involved in signal transduction and cell adhesion in the immune system (PMID: 9597125). CD81 has also been identified as en essential receptor for HCV (hepatitis C virus) (PMID: 21428934). Specification Tested Reactivity: human Cited Reactivity: human, pig, rabbit, monkey Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27298 Product name: Recombinant human CD81 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 114-199 aa of BC002978 Sequence: VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFS Predict reactive species Full Name: CD81 molecule Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC002978 Gene Symbol: CD81 Gene ID (NCBI): 975 ENSEMBL Gene ID: ENSG00000110651 RRID: AB_2882203 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P60033 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.