Proteintech, 66870-1-Ig, KPNA2 Monoclonal antibody

Size: 20ul / 150ul The KPNA2 (66870-1-Ig) by Proteintech is a Monoclonal antibody targeting KPNA2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 66870-1-Ig targets KPNA2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, MCF-7 cells, Jurkat cells, Raji cells Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information KPNA2 (karyopherin α2) is a nuclear import factor involved in the nucleocytoplasmic transport system. It is functionally involved in the tumor progression and is elevated in multiple cancers. KPNA2 expression may be a useful prognostic biomarker to monitor cancer prognosis. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28386 Product name: Recombinant human KPNA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 230-529 aa of BC005978 Sequence: TWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAENLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF Predict reactive species Full Name: karyopherin alpha 2 (RAG cohort 1, importin alpha 1) Calculated Molecular Weight: 57.8 kDa Observed Molecular Weight: 55-58 kDa GenBank Accession Number: BC005978 Gene Symbol: KPNA2 Gene ID (NCBI): 3838 RRID: AB_2882207 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P52292 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.