Proteintech, 66885-1-Ig, PRMT2 Monoclonal antibody

Size: 20ul / 150ul The PRMT2 (66885-1-Ig) by Proteintech is a Monoclonal antibody targeting PRMT2 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 66885-1-Ig targets PRMT2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: SKOV-3 cells, HeLa cells, rat heart tissue, LNCaP cells, Jurkat cells, 4T1 cells Positive IHC detected in: human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PRMT2 (also known as HRMT1L1) is a member of the arginine methyltransferase family which catalyzes arginine methylation and regulates diverse cellular processes, including transcription, translation, DNA repair, and RNA processing. Recently PRMT2 has been identified as a pro-tumorigenic factor in malignant gliomas. Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1806 Product name: Recombinant human PRMT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 134-433 aa of BC000727 Sequence: ESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWIRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR Predict reactive species Full Name: protein arginine methyltransferase 2 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC000727 Gene Symbol: PRMT2 Gene ID (NCBI): 3275 RRID: AB_2882217 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P55345 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.