Proteintech, 66894-1-Ig, DLC1 Monoclonal antibody

Size: 20ul / 150ul The DLC1 (66894-1-Ig) by Proteintech is a Monoclonal antibody targeting DLC1 in WB, IF/ICC, ELISA applications with reactivity to Human samples 66894-1-Ig targets DLC1 in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: NCI-H1299 cells, HepG2 cells, A549 cells Positive IF/ICC detected in: A375 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Deleted in Liver Cancer 1 (DLC1) is a RhoGAP-containing tumor suppressor that inhibits angiogenesis by repressing VEGF production in epithelial cells. DLC1 is often down-regulated in a variety of cancers, such as those of the liver, lung, breast, stomach, brain, colon and prostate due to either genomic deletion or aberrant DNA methylation. Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24404 Product name: Recombinant human DLC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 111-370 aa of BC054511 Sequence: SDEDNNADLCLTDDKQVLNTQGQKTSGQHMIQGAGSLEKALPIIQSNQVSSNSWGIAGETELALVKESGERKVTDSISKSLELCNEISLSEIKDAPKVNAVDTLNVKDIAPEKQLLNSAVIAQQRRKPDPPKDENERSTCNVVQDEFLDTPCTNRGLPLLKTDFGSCLLQPPSCPNGMSAENGLEKSGFSQHQNKSPPKVKAEDGMQCLQLKETLATQEPTDNQVRLRKRKEIREDRDRARLDSMVLLIMKLDQLDQDIE Predict reactive species Full Name: deleted in liver cancer 1 Calculated Molecular Weight: 171 kDa Observed Molecular Weight: 115 kDa GenBank Accession Number: BC054511 Gene Symbol: DLC1 Gene ID (NCBI): 10395 RRID: AB_2882223 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q96QB1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.