Proteintech, 66900-1-Ig, YAP1 Monoclonal antibody

Size: 20ul / 150ul The YAP1 (66900-1-Ig) by Proteintech is a Monoclonal antibody targeting YAP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 66900-1-Ig targets YAP1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NCI-H1299 cells, HUVEC cells, HeLa cells, HSC-T6 cells, NIH/3T3 cells, MCF-7 cells, LNCaP cells, HEK-293 cells, HepG2 cells, NIH-3T3 cells, 4T1 cells Positive IHC detected in: human lung cancer tissue, human colon cancer tissue, human liver cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Yes-associated protein 1 (YAP1) is a transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Plays a key role to control cell proliferation in response to cell contact. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. The presence of TEAD transcription factors are required for it to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction. Isoform 2 and isoform 3 can activate the C-terminal fragment (CTF) of ERBB4 (isoform 3).Increased expression seen in some liver and prostate cancers. Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level). Phosphorylation of S381 primes YAP phosphorylation by CK1δ/ɛ, resulting in activation of a phosphodegron, thus generates a binding surface that interacts with a ubiquitin ligase, and leads to degradation by ubiquitination. (PMID: 20048001). The calcualted molecular weight of YAP1 is 54 kDa, but routinely observed at 65-75 kDa by Western Blot (PMID: 28230103, 33264286, 36255405). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, sheep Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28194 Product name: Recombinant human YAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 155-504 aa of BC038235 Sequence: PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL Predict reactive species Full Name: Yes-associated protein 1, 65kDa Calculated Molecular Weight: 504 aa, 54 kDa Observed Molecular Weight: 65-75 kDa GenBank Accession Number: BC038235 Gene Symbol: YAP1 Gene ID (NCBI): 10413 RRID: AB_2882229 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P46937 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.