Proteintech, 66903-1-Ig, Calnexin Monoclonal antibody

Size: 20ul / 150ul The Calnexin (66903-1-Ig) by Proteintech is a Monoclonal antibody targeting Calnexin in WB, IHC, ELISA applications with reactivity to human, mouse samples 66903-1-Ig targets Calnexin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, RAW 264.7 cells Positive IHC detected in: human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information Calnexin is a molecular chaperone that resides in the endoplasmic reticulum (ER) and participates in the folding and assembly of newly synthesized proteins. Calnexin is highly abundant in ER and is frequently used as an ER marker. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25535 Product name: Recombinant human Calnexin protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-273 aa of BC003552 Sequence: MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPS Predict reactive species Full Name: calnexin Calculated Molecular Weight: 90 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC003552 Gene Symbol: Calnexin Gene ID (NCBI): 821 RRID: AB_2882231 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P27824 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.