Iright
BRAND / VENDOR: Proteintech

Proteintech, 66906-1-Ig, Integrin alpha 6 Monoclonal antibody

CATALOG NUMBER: 66906-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Integrin alpha 6 (66906-1-Ig) by Proteintech is a Monoclonal antibody targeting Integrin alpha 6 in WB, ELISA applications with reactivity to human samples 66906-1-Ig targets Integrin alpha 6 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, JAR cells, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information The integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands (PMID: 17543136). They are transmembrane αβ heterodimers and at least 24 distinct integrin heterodimers are formed by the combination of 18 α and eight β known subunits (PMID: 17543136; 20029421). In addition to mediating cell adhesion, integrins also play important roles in modulating signal transduction pathways that control cellular responses including migration, proliferation, differentiation, and apoptosis (PMID:19118207). Integrin alpha 6 (ITGA6, also known as CD49f or VLA-6) is a 120-kDa single-pass type 1 transmembrane glycoprotein, which combines with the beta 1 subunit (ITGB1, CD29) or beta 4 subunit (ITGB4, CD104) to form heterodimeric laminin receptors (PMID: 1976638; 2351695). Integrin alpha 6 mediates cell-to-cell and cell-to-stroma adhesion. It has also been found in many different stem cell populations and is involved in homing and connecting stem cells to their niches and regulating self-renewal mechanisms in stem cells (PMID: 28494695). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25866 Product name: Recombinant human Integrin alpha-6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 477-690 aa of BC136456 Sequence: TPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTK Predict reactive species Full Name: integrin, alpha 6 Calculated Molecular Weight: 1073 aa, 119 kDa Observed Molecular Weight: 115-120 kDa GenBank Accession Number: BC136456 Gene Symbol: Integrin alpha 6 Gene ID (NCBI): 3655 RRID: AB_2882233 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P23229 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924