Proteintech, 66912-1-Ig, CDC25C Monoclonal antibody

Size: 20ul / 150ul The CDC25C (66912-1-Ig) by Proteintech is a Monoclonal antibody targeting CDC25C in WB, ELISA applications with reactivity to human, mouse, rat samples 66912-1-Ig targets CDC25C in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information The cell division cycle 25 (CDC25) family of proteins are highly conserved dual specificity phosphatases that activate cyclin-dependent kinase (CDK) complexes, which in turn regulate progression through the cell division cycle. CDC25C (cell division cycle 25 homolog C) is one of the 3 isoforms of CDC25 in mammalian cells. It is present in the cytoplasm of asynchronously growing human cells (PMID:10330186). And it may be phosphorylated by its own substrate, an active cdc2-cyclin B complex, to create an autoactivation loop (PMID:7937793). It can be hyperphosphorylated to get the active form of 70 kDa (PMID:18296513). CDC25C has some isofroms with molecular mass of 46-53 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10240 Product name: Recombinant human CDC25C protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-279 aa of BC019089 Sequence: MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQ Predict reactive species Full Name: cell division cycle 25 homolog C (S. pombe) Calculated Molecular Weight: 473 aa, 53 kDa Observed Molecular Weight: 46-53 kDa GenBank Accession Number: BC019089 Gene Symbol: CDC25C Gene ID (NCBI): 995 RRID: AB_2882239 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P30307 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.