Proteintech, 66916-1-Ig, TFG Monoclonal antibody

Size: 20ul / 150ul The TFG (66916-1-Ig) by Proteintech is a Monoclonal antibody targeting TFG in WB, IHC, ELISA applications with reactivity to Human, Pig samples 66916-1-Ig targets TFG in WB, IHC, ELISA applications and shows reactivity with Human, Pig samples. Tested Applications Positive WB detected in: NCI-H1299 cells, A549 cells, MCF-7 cells, HEK-293 cells, PC-3 cells, LNCaP cells Positive IHC detected in: human breast cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Protein TFG (TRK-fused gene protein) plays a role in regulating phosphotyrosine-specific phosphatase-1 activity. Mutations in TFG may have important clinical relevance for current therapeutic strategies to treat metastatic melanoma. Defects in TFG are a cause of thyroid papillary carcinoma (TPC), a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Hereditary motor and sensory neuropathy with proximal dominant involvement (HMSN-P) is an autosomal-dominant neurodegenerative disorder characterized by widespread fasciculations, proximal-predominant muscle weakness, and atrophy followed by distal sensory involvement. Recent genetic investigation indicates that formation of TFG-containing cytoplasmic inclusions and concomitant mislocalization of TAR DNA-binding protein 43 kDa (TDP-43) underlie motor neuron degeneration in HMSN-P. Pathological overlap of proteinopathies involving TFG and TDP-43 highlights a new pathway leading to motor neuron degeneration. Specification Tested Reactivity: Human, Pig Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27697 Product name: Recombinant human TFG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-208 aa of BC023599 Sequence: MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDRSGTPD Predict reactive species Full Name: TRK-fused gene Calculated Molecular Weight: 400 aa, 43 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC023599 Gene Symbol: TFG Gene ID (NCBI): 10342 RRID: AB_2882243 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q92734 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.