Proteintech, 66918-1-Ig, IDH2 Monoclonal antibody

Size: 20ul / 150ul The IDH2 (66918-1-Ig) by Proteintech is a Monoclonal antibody targeting IDH2 in WB, FC (Intra), ELISA applications with reactivity to human samples 66918-1-Ig targets IDH2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells, HepG2 cells, SH-SY5Y cells, K-562 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information IDH2, also named as IDP and ICD-M, belongs to the isocitrate and isopropylmalate dehydrogenases family. It plays a role in intermediary metabolism and energy production. IDH2 is a mitochondrial NADP-dependent isocitrate dehydrogenase that catalyzes oxidative decarboxylation of isocitrate to alpha-ketoglutarate, producing NADPH. It may tightly associate or interact with the pyruvate dehydrogenase complex. IDH1 and IDH2 mutations could also contribute to tumorigenesis and cancer progression through increased mutagenesis. IDH2 has 2 isoforms with the MW of 51 kDa and 45 kDa, and the mature form is about 47 kDa and 41 kDa with the N-terminal transit peptide cleaved. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8950 Product name: Recombinant human IDH2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 104-452 aa of BC009244 Sequence: TQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ Predict reactive species Full Name: isocitrate dehydrogenase 2 (NADP+), mitochondrial Calculated Molecular Weight: 452 aa, 51 kDa Observed Molecular Weight: 41-47 kDa GenBank Accession Number: BC009244 Gene Symbol: IDH2 Gene ID (NCBI): 3418 RRID: AB_2882245 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P48735 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.