Iright
BRAND / VENDOR: Proteintech

Proteintech, 66925-1-Ig, DDX21 Monoclonal antibody

CATALOG NUMBER: 66925-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DDX21 (66925-1-Ig) by Proteintech is a Monoclonal antibody targeting DDX21 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 66925-1-Ig targets DDX21 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HL-60 cells, THP-1 cells Positive IHC detected in: human colon cancer tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information DDX21 protein belongs to DEAD box protein family which is characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD). As a putative RNA helicase, DDX21 unwinds double-stranded RNA, folds single-stranded RNA and is involved in process including ribosomal RNA biogeneis, RNA editing and general transcription. Interaction of DDX21 and c-Jun was reported in ribosomal RNA processing. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17850 Product name: Recombinant human DDX21 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 620-783 aa of BC008071 Sequence: GATSVDQRSLINSNVGFVTMILQCSIEMPNISYAWKELKEQLGEEIDSKVKGMVFLKGKLGVCFDVPTASVTEIQEKWHDSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 21 Calculated Molecular Weight: 783 aa, 87 kDa Observed Molecular Weight: 90-95 kDa GenBank Accession Number: BC008071 Gene Symbol: DDX21 Gene ID (NCBI): 9188 RRID: AB_2882252 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9NR30 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924