Iright
BRAND / VENDOR: Proteintech

Proteintech, 66932-2-Ig, ARH Monoclonal antibody

CATALOG NUMBER: 66932-2-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ARH (66932-2-Ig) by Proteintech is a Monoclonal antibody targeting ARH in WB, FC (Intra), ELISA applications with reactivity to human, rat samples 66932-2-Ig targets ARH in WB, FC (Intra), ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, HEK-293 cells, HepG2 cells, K-562 cells, THP-1 cells, HSC-T6 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, rat Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28608 Product name: Recombinant human LDLRAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-308 aa of BC029770 Sequence: MDALKSAGRALIRSPSLAKQSWGGGGRHRKLPENWTDTRETLLEGMLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYRISYCTADKMHDKVFAYIAQSQHNQSLECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPPLKSLVATGNLLDLEETAKAPLSTVSANTTNMDEVPRPQALSGSSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLTAQDMHYAQCLSPVDWDKPDSSGTEQDDLFSF Predict reactive species Full Name: low density lipoprotein receptor adaptor protein 1 Calculated Molecular Weight: 308 aa, 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC029770 Gene Symbol: ARH Gene ID (NCBI): 26119 RRID: AB_2882258 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q5SW96 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924