Proteintech, 66941-1-Ig, RDM1 Monoclonal antibody

Size: 20ul / 150ul The RDM1 (66941-1-Ig) by Proteintech is a Monoclonal antibody targeting RDM1 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples 66941-1-Ig targets RDM1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: PC-3 cells, HEK-293 cells, HSC-T6 cells, RAW 264.7 cells Positive IHC detected in: human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RDM1, also named as RAD52B, encodes a RNA recognition motif (RRM)-containing protein confered resistance to the antitumor agent cisplatin. The expression of RDM1 is closely related to the cell proliferation and apoptosis of thyroid carcinoma cells and RDM1 may be a potential marker of lung adenocarcinoma. RDM1 has many isoforms (8 kDa, 12-19 kDa and 25-32 kDa) with long or short N-terminus and a great diversity in the exonic composition of C-terminus generated by alternative pre-mRNA splicing and differential usage of two translational start sites. RDM1 protein can be expressed differently in cytoplasm or nuclear/nucleolar in the absence of stress, proteotoxic stress and mild heat shock, suggesting functional differences among the RDM1 proteins. ( PMID: 28939762, 17905820, 28939762, 30069034) Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28686 Product name: Recombinant human RDM1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-253 aa of BC038301 Sequence: QHSLFTAFSQFGLLYSVRVFPNAAVAHPGFYAVIKFYSARAAHRAQKACDRKQLFQKSPVKVRLGTRHKAVQHQALALNSSKCQELANYCFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLVEEPMDKVEEGPLSFLMKRKTAQKLAIQKALSDAFQKLLIVVLESGKIAVEYRPSEDIVGVRCEEELHGLIQVPCSPWKQYGQEEEGYLSDFSLEEEEFRLPELD Predict reactive species Full Name: RAD52 motif 1 Calculated Molecular Weight: 284 aa, 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC038301 Gene Symbol: RDM1 Gene ID (NCBI): 201299 RRID: AB_2882265 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8NG50 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.