Proteintech, 66948-1-Ig, TMEM119 Monoclonal antibody

Size: 20ul / 150ul The TMEM119 (66948-1-Ig) by Proteintech is a Monoclonal antibody targeting TMEM119 in WB, ELISA applications with reactivity to Human, Pig, Mouse, Rat, rabbit samples 66948-1-Ig targets TMEM119 in WB, ELISA applications and shows reactivity with Human, Pig, Mouse, Rat, rabbit samples. Tested Applications Positive WB detected in: rabbit brain tissue, rat brain tissue, mouse brain tissue, pig cerebellum tissue, pig brain tissue, rat cerebellum tissue, mouse cerebellum tissue, Rabbit cerebellum tissue, Chicken brain tissue Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Background Information TMEM119 immunohistochemistry might provide a useful tool for investigating the biology and pathology of human microglia(PMID: 26250788). Microglia can be detected clearly using Catalog#66948-1-Ig. The predicted MW of TMEM119 is 29 kDa. Catalog#66948-1-Ig recognizes 50 kDa band may due to glycosylation. Specification Tested Reactivity: Human, Pig, Mouse, Rat, rabbit Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG3 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26286 Product name: Recombinant human TMEM119 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 119-218 aa of NM_181724 Sequence: MRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQE Predict reactive species Full Name: transmembrane protein 119 Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: NM_181724 Gene Symbol: TMEM119 Gene ID (NCBI): 338773 RRID: AB_2882272 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q4V9L6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.