Iright
BRAND / VENDOR: Proteintech

Proteintech, 66983-1-Ig, TRPV1 Monoclonal antibody

CATALOG NUMBER: 66983-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TRPV1 (66983-1-Ig) by Proteintech is a Monoclonal antibody targeting TRPV1 in WB, ELISA applications with reactivity to human samples 66983-1-Ig targets TRPV1 in WB, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, MDA-MB-468 cells, T-47D cells, HEK-293 cells, Y79 cells, HUVEC cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information TRPV1, also named as VR1 or OTRPC1, belongs to the transient receptor potential (TRP) family and TRPV subfamily (PMID: 17579562). TRPV1 is a ligand-activated non-selective calcium permeant cation channel expressed predominantly by sensory neurons (PMID: 10821274). It is involved in detection of noxious chemical and thermal stimuli. TRPV1 plays an important role in inflammatory thermal hyperalgesia (PMID: 10764638; 10821274). Specification Tested Reactivity: human Cited Reactivity: human, sheep Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18683 Product name: Recombinant human TRPV1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-203 aa of BC132820 Sequence: MKKWSSTDLGAAADPLQKDTCPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKSKKHLTDNEFKDPETGKTCLLKAMLNLHDGQNTTIPLLLEIARQTDSLKELVNASYTDSYYKGQ Predict reactive species Full Name: transient receptor potential cation channel, subfamily V, member 1 Calculated Molecular Weight: 839 aa, 95 kDa Observed Molecular Weight: 105 kDa GenBank Accession Number: BC132820 Gene Symbol: TRPV1 Gene ID (NCBI): 7442 RRID: AB_2882302 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8NER1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924