Iright
BRAND / VENDOR: Proteintech

Proteintech, 66984-1-Ig, Band 3/AE 1 Monoclonal antibody

CATALOG NUMBER: 66984-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Band 3/AE 1 (66984-1-Ig) by Proteintech is a Monoclonal antibody targeting Band 3/AE 1 in IHC, IF-P, ELISA applications with reactivity to human samples 66984-1-Ig targets Band 3/AE 1 in IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human placenta tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:5000-1:20000 Immunofluorescence (IF)-P: IF-P : 1:400-1:1600 Background Information Anion exchanger 1 (AE1), also known as band 3, is a 95-100 kDa transmembrane glycoprotein which is abundantly expressed in erythrocyte plasma membrane and mediates the electroneutral exchange of Cl- and HCO3-. It contains a 52-55 kDa C-terminal membrane crossing domain and a 43 kDa N-terminal cytoplasmic domain. Degradation of band 3 protein occurred during erythrocyte aging. The oxidative stress can also activate the proteolysis of band 3 through caspases. This antibody is expected to recognize the intact band 3 (95-100 kDa) and various degradation products (38-60 kDa). (PMID: 22890269, 29240292, 28130418) Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28058 Product name: Recombinant human SLC4A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-200 aa of BC101570 Sequence: MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLF Predict reactive species Full Name: solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group) Calculated Molecular Weight: 911 aa, 102 kDa GenBank Accession Number: BC101570 Gene Symbol: band 3 Gene ID (NCBI): 6521 RRID: AB_2918479 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P02730 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924