Proteintech, 67000-1-Ig, PTPRO Monoclonal antibody

Size: 20ul / 150ul The PTPRO (67000-1-Ig) by Proteintech is a Monoclonal antibody targeting PTPRO in WB, IHC, IF-P, ELISA applications with reactivity to human, pig samples 67000-1-Ig targets PTPRO in WB, IHC, IF-P, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: pig kidney tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:400-1:1600 Background Information PTPRO(receptor-type tyrosine-protein phosphatase O) is also named as GLEPP1, PTPU2 and belongs to the protein-tyrosine phosphatase family. The protein is a receptor-like membrane protein tyrosine phosphatase expressed at the apical membrane of the podocyte foot processes in the kidney(PMID:21722858). The 1,159-amino acid predicted mature protein contains a large extracellular domain, a single transmembrane domain, and a single intracellular PTPase domain. Defects in PTPRO are the cause of nephrotic syndrome type 6 (NPHS6). In reducing conditions, PTPRO can form a smear from 180 to 220 kDa; In non-reducing conditions, a band appeares around 350 kDa, which likely represents the dimeric form of full-length PTPRO (PMID: 19573017). Specification Tested Reactivity: human, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8284 Product name: Recombinant human PTPRO protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 298-597 aa of BC035960 Sequence: YWWDSASAAPESEDEFVSVLPMEYENNSTLSETEKSTSGSFSFFPVQMILTWLPPKPPTAFDGFHIHIEREENFTEYLMVDEEAHEFVAELKEPGKYKLSVTTFSSSGSCETRKSQSAKSLSFYISPSGEWIEELTEKPQHVSVHVLSSTTALMSWTSSQENYNSTIVSVVSLTCQKQKESQRLEKQYCTQVNSSKPIIENLVPGAQYQVVIYLRKGPLIGPPSDPVTFAIVPTGIKDLMLYPLGPTAVVLSWTRPYLGVFRKYVVEMFYFNPATMTSEWTTYYEIAATVSLTASVVIFP Predict reactive species Full Name: protein tyrosine phosphatase, receptor type, O Calculated Molecular Weight: 138 kDa Observed Molecular Weight: 160 kDa, 180-220 kDa GenBank Accession Number: BC035960 Gene Symbol: PTPRO Gene ID (NCBI): 5800 RRID: AB_2882317 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q16827 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.