Proteintech, 67014-1-Ig, ICAM4 Monoclonal antibody

Size: 20ul / 150ul The ICAM4 (67014-1-Ig) by Proteintech is a Monoclonal antibody targeting ICAM4 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 67014-1-Ig targets ICAM4 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human blood tissue, human red blood cells Positive IHC detected in: human spleen tissue, human colon tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunohistochemistry (IHC): IHC : 1:2500-1:10000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. The protein migrate as a 42 kDa glycoprotein on SDS PAGE. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27628 Product name: Recombinant human ICAM4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 23-152 aa of BC029364 Sequence: ALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLR Predict reactive species Full Name: intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) Calculated Molecular Weight: 271 aa, 29 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC029364 Gene Symbol: ICAM4 Gene ID (NCBI): 3386 RRID: AB_2882330 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q14773 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.