Iright
BRAND / VENDOR: Proteintech

Proteintech, 67018-1-Ig, STBD1 Monoclonal antibody

CATALOG NUMBER: 67018-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The STBD1 (67018-1-Ig) by Proteintech is a Monoclonal antibody targeting STBD1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 67018-1-Ig targets STBD1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: LNCaP cells, HEK-293 cells, A549 cells, HeLa cells, HepG2 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information STBD1 may have the capability to bind to carbohydrates. It functions as a glycogen receptor that tethers glycogen to autophagic membranes for delivery and breakdown in lysosomes. STBD1 appears molecular mass of 35-38 kDa band in mouse/rat tissues and 38-43 kDa in human tissue. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28613 Product name: Recombinant human STBD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 26-358 aa of BC022301 Sequence: GPGDTGKDGDAEQEKDAPLGGAAIPGGHQSGSSGLSPGPSGQELVTKPEHLQESNGHLISKTKDLGKLQAASWRLQNPSREVCDNSREHVPSGQFPDTEAPATSETSNSRSYSEVSRNESLESPMGEWGFQKGQEISAKAATCFAEKLPSSNLLKNRAKEEMSLSDLNSQDRVDHEEWEMVPRHSSWGDVGVGGSLKAPVLNLNQGMDNGRSTLVEARGQQVHGKMERVAVMPAGSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGRWNTYIPLHYNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKVVHAWWGIH Predict reactive species Full Name: starch binding domain 1 Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC022301 Gene Symbol: STBD1 Gene ID (NCBI): 8987 RRID: AB_2882334 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O95210 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924