Iright
BRAND / VENDOR: Proteintech

Proteintech, 67030-1-Ig, PR3/PRTN3 Monoclonal antibody

CATALOG NUMBER: 67030-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PR3/PRTN3 (67030-1-Ig) by Proteintech is a Monoclonal antibody targeting PR3/PRTN3 in WB, IHC, IF-P, ELISA applications with reactivity to human samples 67030-1-Ig targets PR3/PRTN3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Positive IHC detected in: human spleen tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25915 Product name: Recombinant human PRTN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 89-150 aa of BC096183 Sequence: NVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGT Predict reactive species Full Name: proteinase 3 Calculated Molecular Weight: 256 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC096183 Gene Symbol: PRTN3 Gene ID (NCBI): 5657 RRID: AB_2882345 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P24158 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924