Iright
BRAND / VENDOR: Proteintech

Proteintech, 67031-1-Ig, SPINT1/HAI-1 Monoclonal antibody

CATALOG NUMBER: 67031-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SPINT1/HAI-1 (67031-1-Ig) by Proteintech is a Monoclonal antibody targeting SPINT1/HAI-1 in WB, IF/ICC, ELISA applications with reactivity to human samples 67031-1-Ig targets SPINT1/HAI-1 in WB, IF/ICC, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Hepatocyte growth factor activator inhibitor type 1 (HAI-1) is also named as SPINT1 and Kunitz-type protease inhibitor 1. HAI-1 is critical to control matriptase proteolytic activity (PMID: 25310042). HAI-1 inhibits matriptase activity through forming complex with activated matriptase (PMID: 30370662). matriptase, HAI‐1 also binds to and inhibits a variety of serine proteases including of hepsin, plasmin, prostasin, TMPRSS13 and HAT. HAI-1 as a cell-autonomous tumor suppressor that negatively regulates the HGF pathway (PMID: 25925948). HAI-1 is inhibitor of HGFAC (PMID: 9045658). HAI-1 inhibits serine protease activity of ST14/matriptase in vitro (PMID: 28710277). HAI-1 inhibits serine protease activity of TMPRSS13, via the BPTI/Kunitz inhibitor 1 domain (PMID: 20977675). HAI-1 expression is reduced in many cancer types, which is implicated in the progression of cancer and is associated with a worse prognosis in cancer patients (PMID: 30370662). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26733 Product name: Recombinant human SPINT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 307-441 aa of BC004140 Sequence: SMERRHPVCSGTCQPTQFRCSNGCCIDSFLECDDTPNCPDASDEAACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIP Predict reactive species Full Name: serine peptidase inhibitor, Kunitz type 1 Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC004140 Gene Symbol: HAI-1 Gene ID (NCBI): 6692 RRID: AB_2882346 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O43278 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924