Proteintech, 67038-1-Ig, MED30 Monoclonal antibody

Size: 20ul / 150ul The MED30 (67038-1-Ig) by Proteintech is a Monoclonal antibody targeting MED30 in WB, ELISA applications with reactivity to Human, rat, pig samples 67038-1-Ig targets MED30 in WB, ELISA applications and shows reactivity with Human, rat, pig samples. Tested Applications Positive WB detected in: HeLa cells, pig brain tissue, rat brain tissue, HEK-293 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information MED30, also named as THRAP6 and TRAP25, is a component of the Mediator complex. MED30 has two isoforms with MW 16-20 kDa ad 20-25 kDa. Specification Tested Reactivity: Human, rat, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10235 Product name: Recombinant human MED30 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-178 aa of BC008226 Sequence: MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN Predict reactive species Full Name: mediator complex subunit 30 Calculated Molecular Weight: 178 aa, 20 kDa Observed Molecular Weight: 20-25 kDa GenBank Accession Number: BC008226 Gene Symbol: MED30 Gene ID (NCBI): 90390 RRID: AB_2882352 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96HR3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.