Iright
BRAND / VENDOR: Proteintech

Proteintech, 67039-1-Ig, Flightless I Monoclonal antibody

CATALOG NUMBER: 67039-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Flightless I (67039-1-Ig) by Proteintech is a Monoclonal antibody targeting Flightless I in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples 67039-1-Ig targets Flightless I in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, A549 cells, NCI-H1299 cells, Jurkat cells, NIH/3T3 cells, HSC-T6 cells, HepG2 cells, MCF-7 cells, NCCIT cells, HT-1080 cells, LNCaP cells Positive IHC detected in: human colon cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information Flightless I (FliI) is the most evolutionarily conserved member of the gelsolin superfamily of proteins which are key regulators of actin filament assembly and turnover. FliI comprises an N-terminal leucine-rich repeat (LRR) domain which is not present in other gelsolin family members, and the LRR domain may enable interactions between FliI and other molecules involved in signal transduction, thereby spatially integrating signaling and actin remodeling functions. This protein was originally found in Drosophila and participates in the embryonic development, while mammalian FliI protein was involved in the regulation of wound repair,skin barrier development. Studies recently demonstrated that FliI protein associated with colorectal cancer, hepatocellular and prostate cancer (PMID:30091651; 28498392). Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26865 Product name: Recombinant human FLII protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 440-900 aa of BC025300 Sequence: DQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGTSLDPRFVFLLDRGLDIYVWRGAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGEPSEIKKHVPEDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKQRPKVELMPRMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEW Predict reactive species Full Name: flightless I homolog (Drosophila) Calculated Molecular Weight: 1269 aa, 145 kDa Observed Molecular Weight: 145-150 kDa GenBank Accession Number: BC025300 Gene Symbol: Flightless I Gene ID (NCBI): 2314 RRID: AB_2882353 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13045 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924