Iright
BRAND / VENDOR: Proteintech

Proteintech, 67051-1-Ig, IL-4RA/CD124 Monoclonal antibody

CATALOG NUMBER: 67051-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IL-4RA/CD124 (67051-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-4RA/CD124 in WB, ELISA applications with reactivity to human samples 67051-1-Ig targets IL-4RA/CD124 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, Jurkat cells, MG-63 cells, SCaBER cells, HT-1376 cells, Raji cells, Ramos cells, Daudi cells, HUVEC cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information IL-4 receptor alpha chain (IL-4RA), also known as CD124, is a transmembrane glycoprotein expressed on a wide variety of hematopoietic and non-hematopoietic cells. It is a receptor for both IL-4 and IL-13. IL-4RA can complex with the common gamma chain (IL-2R gamma or CD132) and utilizes JAK1 and JAK2 for signal transduction, while complexes of IL-4RA with IL-13RA1 subunit mediate signals via JAK2 and Tyk2. The IL-4 response is involved in promoting Th2 differentiation. The IL-4/IL-13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28411 Product name: Recombinant human IL-4R protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 26-232 aa of NM_000418 Sequence: MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH Predict reactive species Full Name: interleukin 4 receptor Calculated Molecular Weight: 90 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: NM_000418 Gene Symbol: IL-4R Gene ID (NCBI): 3566 RRID: AB_2882364 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P24394 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924